PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5AL_0CAD19709.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 872aa    MW: 100089 Da    PI: 7.0031
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5AL_0CAD19709.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR174.71.9e-23120206190
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fY +YA ++GF+vrk  s+k+  n+ + +r +vCskeg++ ++ ++  + +++rae rtgC+a+++v+ +++gk++vt+ + +HnH+
  Traes_5AL_0CAD19709.1 120 EFYVSYAGTAGFNVRKGCSEKT-ANNVTRSRSYVCSKEGFHPKSVTA--EPKKQRAEIRTGCEAHMTVRITTSGKYVVTEYVADHNHD 204
                            6*****************9999.66669**************99988..9999**********************************9 PP

                   FAR1  89 la 90 
                            l 
  Traes_5AL_0CAD19709.1 205 LE 206
                            95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.9E-21120206IPR004330FAR1 DNA binding domain
PfamPF105513.3E-24306400IPR018289MULE transposase domain
PROSITE profilePS5096610.287574621IPR007527Zinc finger, SWIM-type
PfamPF044344.9E-6574618IPR007527Zinc finger, SWIM-type
SMARTSM005752.1E-6596623IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 872 aa     Download sequence    Send to blast
ICNTVLCGLW TVEYDVSRPH CYNEAHILAH FRKKIVSCQA LAERRKRGDG GRFLSSDGPL  60
PSERRSKRLE KQNLKNEKKP ESKEDEIVEA EQDPETEVVA GPGGEPKVGM VFLNEDKAYE  120
FYVSYAGTAG FNVRKGCSEK TANNVTRSRS YVCSKEGFHP KSVTAEPKKQ RAEIRTGCEA  180
HMTVRITTSG KYVVTEYVAD HNHDLEAPLV DIQILRSQKL LAKLQQPPDP PKVVLIPNDY  240
KNYVRTRHTK DMQSGDAQAI SEYLQRMKGK NPSFFCSIQV DEDDQFRNVF WADVKSVMDF  300
NYFGDVVCVD TRYSTSDYCR PLLLFIGVNH HKEPTIFGTA FIYDESVESF KWLFETFKSA  360
MSGKQPRTVL TDRSTAISDA VASAWPGTAH RFSLLHLYQN ATKVLSDTFQ GSETFAHDFS  420
RSLYDYEEEG DFLSSWEILL AKYNLKDNEW LSKLYEDRER WALPYGRDIF CADIAATLRS  480
DNMDAILTGV LKTEIDLPYF FNRYDKFLEE KRLAEQQADY LGVQMTQRVP PLRLLWQAAN  540
TYTPALFEMF RLEFELVLSC MVYCCGEIGP ISEYEVTVKN RPQVHFVRFD SSEYMVVCSC  600
KKFEFVGLPC CHVLKVLEIK NIKELPPQYI LKRWRKDAQS ESPKENFGFA AVDEDPKFTV  660
SKRHNSLYRT LYKVAAKAAE NIEGQRFMES QYDQLLEQVE LLLQAKLHDK PSLSTIMRSQ  720
QPNLPQNDTS NSEPRRASSK KNKNVENRRQ QQSPLESSKK KKGRQGLVEP EEAELPLRVL  780
APTISNDIPN HMSTPTNQFL APNHIMQAPY VTQQFGLNSL QGFSGMTPFG QMQEQSPVHL  840
QQPHLQQSPF HGGPQMHQFS PWEIFMYSLR SE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13146RKKIVSCQALAERRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3600420.0AK360042.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1108P13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558513.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like isoform X1
TrEMBLW5EUK30.0W5EUK3_WHEAT; Uncharacterized protein
STRINGMLOC_17927.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-110FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]